3.85 Rating by CuteStat

saidayouth.com is 4 years 11 months old. It is a domain having com extension. It has a global traffic rank of #1706074 in the world. This website is estimated worth of $ 720.00 and have a daily income of around $ 3.00. As no active threats were reported recently by users, saidayouth.com is SAFE to browse.

PageSpeed Score
54
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 493
Daily Pageviews: 986

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,706,074
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

40.123.218.186

Hosted Country:

United Arab Emirates AE

Location Latitude:

25.2633

Location Longitude:

55.3087
الصفحة الرئيسية - موقع شباب صيدا

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: 8 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 16
Google Adsense: Not Applicable Google Analytics: UA-143309422-1

HTTP Header Analysis

HTTP/1.1 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
X-Frame-Options: SAMEORIGIN
Date: Wed, 25 Mar 2020 15:35:21 GMT
Content-Length: 46983

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: May 21, 2019, 1:27 PM 4 years 11 months 2 weeks ago
Expiration Date: May 21, 2020, 1:27 PM 3 years 11 months 2 weeks ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
ns1-03.azure-dns.com 13.107.236.3 United States of America United States of America
ns2-03.azure-dns.net 150.171.21.3 United States of America United States of America
ns3-03.azure-dns.org 204.14.183.3 United States of America United States of America
ns4-03.azure-dns.info 208.84.5.3 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
saidayouth.com A 3594 IP: 40.123.218.186
saidayouth.com NS 172800 Target: ns3-03.azure-dns.org
saidayouth.com NS 172800 Target: ns4-03.azure-dns.info
saidayouth.com NS 172800 Target: ns1-03.azure-dns.com
saidayouth.com NS 172800 Target: ns2-03.azure-dns.net
saidayouth.com SOA 3600 MNAME: ns1-03.azure-dns.com
RNAME: azuredns-hostmaster.microsoft.com
Serial: 1
Refresh: 3600
Retry: 300
Expire: 2419200
Minimum TTL: 300
saidayouth.com TXT 3600 TXT: google-site-verification=tazMjn7rUX4c3K_
ffPvfOTVgoioJrnY4dqiY94blJSQ

Similarly Ranked Websites

Osborne Samuel - Modern and Contemporary Art - London Gallery

- osbornesamuel.com

OSBORNE SAMUEL GALLERY is one of London’s leading galleries, long established in the heart of Mayfair. The gallery began as Berkeley Square Gallery and became

1,706,077 $ 720.00

Carquest Auto Parts® - Canada - Francais and English

- carquest.ca

More than 300 auto parts stores throughout Canada, suppling the professional automotive service repair industry with replacement parts, tools and equipment.

1,706,077 $ 720.00

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Home - Social Media Famous

- socialmediafamous.com

Find high-quality & affordable social media famous influncers that match your brand. Never deal with fake influencers again by using our real-time reporting on account growth history, engagement rate, average likes, comments, and more. Try it free today.

1,706,086 $ 720.00

Browse Instagram Influencers - Social Media Famous

- dash.socialmediafamous.com
1,706,086 $ 720.00

Full WHOIS Lookup

Domain Name: saidayouth.com
Registry Domain ID: 2393249693_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-05-21T07:42:40Z
Creation Date: 2019-05-21T07:42:39Z
Registrar Registration Expiration Date: 2020-05-21T07:42:39Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: N/A
Registrant Country: QA
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=saidayouth.com
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=saidayouth.com
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=saidayouth.com
Name Server: NS1-03.AZURE-DNS.COM
Name Server: NS2-03.AZURE-DNS.NET
Name Server: NS3-03.AZURE-DNS.ORG
Name Server: NS4-03.AZURE-DNS.INFO
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-03-25T15:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.